PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.7NG402400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MIKC_MADS
Protein Properties Length: 248aa    MW: 28462.7 Da    PI: 9.4106
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.7NG402400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF83.31.5e-26959151
                         S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
               SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                         k+ien +nrqvtfskRr g+lKKA+EL +LCda++ viifs +g++yeyss
  Pavir.7NG402400.1.p  9 KKIENPTNRQVTFSKRRMGLLKKANELAILCDAQIGVIIFSGSGRMYEYSS 59
                         68***********************************************96 PP

2K-box56.21.5e-19851621491
                K-box  14 aeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeen 91 
                          +++  qe++++k+e + L+    h +GedL s s+++L +Leqq+e sl k+R +K+ell +q+ e++++ +e++  +
  Pavir.7NG402400.1.p  85 QQKIIQEMTRMKDERNRLRIIMGHCMGEDLASFSVEDLSNLEQQMEFSLYKVRLRKQELLDQQLLEMRHRVREMHMSE 162
                          68899*******************************************************************999765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.0E-38160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.371161IPR002100Transcription factor, MADS-box
SuperFamilySSF554558.89E-30279IPR002100Transcription factor, MADS-box
CDDcd002659.51E-39276No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004045.2E-28323IPR002100Transcription factor, MADS-box
PfamPF003191.2E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004045.2E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004045.2E-283859IPR002100Transcription factor, MADS-box
PfamPF014862.2E-1681162IPR002487Transcription factor, K-box
PROSITE profilePS5129712.30185185IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
MGRGKVELKK IENPTNRQVT FSKRRMGLLK KANELAILCD AQIGVIIFSG SGRMYEYSSP  60
PWRIANIFDR YLKAPSTRFE EMDIQQKIIQ EMTRMKDERN RLRIIMGHCM GEDLASFSVE  120
DLSNLEQQME FSLYKVRLRK QELLDQQLLE MRHRVREMHM SEEQSGYLCL MDPAARGQSQ  180
AAEMAANPRP FPWWDVGASA SASGSQRPHG RDAEPSVTAL QLSPRLHGYR LQPRQPNLQD  240
ASLHGWL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P4e-17160160Myocyte-specific enhancer factor 2B
1tqe_Q4e-17160160Myocyte-specific enhancer factor 2B
1tqe_R4e-17160160Myocyte-specific enhancer factor 2B
1tqe_S4e-17160160Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0385321e-167BT038532.1 Zea mays full-length cDNA clone ZM_BFb0284C04 mRNA, complete cds.
GenBankBT0691331e-167BT069133.1 Zea mays full-length cDNA clone ZM_BFb0202H05 mRNA, complete cds.
GenBankHQ8587371e-167HQ858737.1 Zea mays clone UT1435 MADS transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004976800.11e-149PREDICTED: MADS-box transcription factor 31-like
SwissprotQ84NC26e-91MAD31_ORYSJ; MADS-box transcription factor 31
TrEMBLA0A096S8I01e-143A0A096S8I0_MAIZE; Uncharacterized protein
STRINGGRMZM2G135018_P011e-143(Zea mays)
STRINGGRMZM2G070151_P021e-141(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP185037100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23260.21e-41MIKC_MADS family protein